capralogics

Human Toll-like receptor 5 (TLR5) Extracellular Domain

Toll-like receptors (TLRs) are membrane proteins on many cells involved with innate immunity such as macrophages, dendritic cells, neutrophils, mucosal epithelial cells, and endothelial cells.  Ten different mammalian TLRs have been identified and all have distinct specificities for microbial ligands.  Upon recognition of a microbial product, TLRs initiate a signaling pathway to activate innate immunity.  TLR5, also known as Toll/interleukin-1 receptor-like protein 3 (TIL3), recognizes flagellin from various bacteria.

Specificity: Peptide sequence is < 50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR5 and was not tested for cross-reactivity to mouse TLR5.

Formulation: Liquid. 200 µg of affinity purified antibody in 10 mM KHPO4, 140 mM NaCl with 1 mg/ml BSA and buffers containing 0.1 % sodium azide.

Quality Control: Immunohistochemistry on human spleen

Storage: Freeze at -20° C. For long term storage freeze at -70° C. Avoid freeze-thaw cycles.

capralogics

IH on paraffin section of human spleen
Contact Capralogics
antibodyinfo@capralogics.com
FAX 1-413-643-0067
Phone 1-800-975-6866

Product Number CIO134
Amount 200 µg in 100 µl
Price $ 295
Host Goat
Antigen

Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5
Purification Peptide affinity purified
Species Cross- Reactivity Not tested
Buffer 10 mM KHPO4, 140 mM NaCl
pH 7.2
*
Applications and Protocols  
ELISA (peptide) 1:75,000
Western Blotting (WB)

1:100
Immunocytochemistry (IC) 1:500
Immunohistochemistry (IH) 1:250
Flow Cytometry (FC) 1:200

For Research Purposes Only
Citations and Applications

Crellin NK, Garcia RV, Hadisfar O, Allan SE, Steiner TS, Levings MK.  Human CD4+ T cells express TLR5 and its ligand flagellin enhances the suppressive capacity and expression of FOXP3 in CD4+CD25+ T regulatory cells.  J Immunol. 2005 Dec 15;175(12):8051-9. Full Text FC

Maaser C, Heidemann J, von Eiff C, Lugering A, Spahn TW, Binion DG, Domschke W, Lugering N, Kucharzik T. Human intestinal microvascular endothelial cells express Toll-like receptor 5: a binding partner for bacterial flagellin.  J Immunol. 2004 Apr 15;172(8):5056-62.  Full Text WB

Anti-actin, Capralogics Home, Chemokine Receptors,, Citations, Contact Us, Custom Polyclonal Antibodies, FAQ, GLP Compliance, Diagnostic Antibody Production, Interleukins, IVD Antibodies, Licenses and Assurances, Polyclonal Antibody Production, "Scrapie Free" Goats, Toll-Like Receptors, Quality Commitment, Welcome to Capralogics

©2007 Capralogics, Inc.