Antibody to Interleukin 21 (human) Receptor

DATASHEET

Specificity: Peptide sequence is < 50 % identical to other sequences in GenBank. The antibody recognizes human IL-21 receptor and was not tested for cross-reactivity to mouse IL-21 receptor.

Formulation: Liquid 200 µg of affinity purified antibody in 10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide

Quality Control: Immunohistochemistry on human lung or/and human tonsil.

Storage: Freeze at -20 °C or colder. Stable for at least 3 years when stored at -80°C. Avoid freeze/thaw cycles.

capralogics anti human IL21 receptor

Immunohistochemistry on human lung with goat antibody to N-terminus of human IL-21 receptor

For Research Purposes Only

Contact Capralogics
antibodyinfo@capralogics.com
FAX 1-413-643-0067
Phone 1-800-975-6866

Product Number CIO149

Price $ 295 buy online
Amount 200 µg
Host Species Goat
Antigen Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to 35-65 residues of N-terminus of human IL-21 receptor.
Sequence Alignment

CILEMWNLHPSTLTLTWQDQYEELKDEATS Human IL-21 Receptor
CVLETRSPNPSILSLTWQDEYEELQDQETF Mouse IL-21 Receptor

Antibody Concentration

1.0 mg/mL

Purification Peptide affinity purified
Species Cross- Reactivity not tested
Buffer 10 mM KHPO4, 140 mM NaCl
pH 7.2
*
Applications and Protocols  
ELISA >1:100000
Immunohistochemistry 1:300
Flow Cytometry ND
Citation and Application
Dien Bard J, Gelebart P, Anand M, Zak Z, Hegazy SA, Amin HM, Lai R. IL-21 contributes to JAK3/STAT3 activation and promotes cell growth in ALK-positive anaplastic large cell lymphoma. Am J Pathol. 2009 Aug;175(2):825-34 Abstract IH

Capralogics >> Interleukin Antibodies