 DATASHEET
Specificity: This
antibody recognizes the N-terminus region of human
interleukin-22 receptor alpha-2 chain precursor (IL-22R-alpha-2) which is also known as IL-22-binding protein (IL22BP), cytokine receptor family class II member 10 (CRF2-10), and cytokine receptor family type 2, soluble 1 (CRF2-S1).
This
antibody is likely to recognize rat and mouse IL-22 RA2 protein due to sequence similiarity. The peptide sequence is < 50 % identical
to other sequences in GenBank.
Formulation: Liquid 200 µg of affinity
purified antibody in 10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide.
Quality Control: Immunohistochemistry
on human spleen and/or human tonsil
Storage: Freeze at -20° C. For long
term storage freeze at -80° C. Stable for at
least 3 years when stored at -80°C. Avoid freeze-thaw cycles.
CI0150 IH with
paraffin section of human spleen Larger Image
|
| |
| Price |
$ 295 |
| Amount |
200 µg |
| Host |
Goat |
| Antigen |
Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C
corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein |
| Antibody Concentration |
2.0 mg/mL
|
| Purification |
Peptide affinity purified |
| Species Cross-Reactivity |
Rat and mouse |
| Sequence Alignment |
RVQFQSRNFHNILQWQPGRALTGNSSVY
Human
KVRFQSRNFHNILHWQAGSSLPSNNSIY
Mouse
KVQFQSRNFHNILHWQPGNSLTSNGSVY
Rat
|
| Buffer |
10 mM KHPO4, 140 mM NaCl |
| pH |
7.2 |
|
For Research Purposes Only |
| Literature Reference: Xu W, Presnell SR, Parrish-Novak J, Kindsvogel W, Jaspers S, Chen Z, Dillon SR, Gao Z, Gilbert T, Madden K, Schlutsmeyer S, Yao L, Whitmore TE, Chandrasekher Y, Grant FJ, Maurer M, Jelinek L, Storey H, Brender T, Hammond A, Topouzis S, Clegg CH, Foster DC. A soluble class II cytokine receptor, IL-22RA2, is a naturally occurring IL-22 antagonist. Proc Natl Acad Sci U S A. 2001 Aug 14;98(17):9511-6. Full Text |
