F(ab')2 to mouse Interleukin-21 Receptor

DATASHEET

Specificity:  This F(ab')2 antibody recognizes mouse interleukin-21 receptor and the peptide sequence is less than 50% similiar to other sequences in GenBank in this region.  CI0156 was not tested for cross-reactivity to human IL-21 receptor.

Formulation: Liquid 100 µl of affinity purified antibody in 10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide

Quality Control: Immunohistochemistry on mouse spleen or thymus

Storage: Freeze at -20 °C or colder. Stable for at least 3 years when stored at -80°C. Avoid freeze/thaw cycles.

IH on mouse thymus with F(ab')2 rabbit antibody to mouse IL-21 receptor

Contact Capralogics
antibodyinfo@capralogics.com
FAX 1-413-643-0067
Phone 1-800-975-6866

Product Number CIO156

Amount 100 µl
Price $295 buy online
Host Rabbit
Antigen Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouse IL-21 receptor
Sequence Alignment

CVLETRSPNPSILSLTWQDEYEELQDQETF Mouse IL-21 receptor
CILEMWNLHPSTLTLTWQDQYEELKDEATS Human IL-21 Receptor

Purification Peptide affinity purified
Species Cross- Reactivity not tested
Buffer 10 mM KHPO4, 140 mM NaCl
pH 7.2
Applications and Protocols  
ELISA (peptide) 1:50000
Immunohistochemistry (IH) 1:250
Flow Cytometry 1:25

For Research Purposes Only

Flow Cytometry Reference
Comes A, Rosso O, Orengo AM, Di Carlo E, Sorrentino C, Meazza R, Piazza T, Valzasina B, Nanni P, Colombo MP, Ferrini S. CD25+ regulatory T cell depletion augments immunotherapy of micrometastases by an IL-21-secreting cellular vaccine.  J Immunol. 2006 Feb 1;176(3):1750-8. Abstract

Capralogics Home >> Interleukin Antibodies