capralogics inc

Human Toll-like receptor 9 (TLR9)

capralogics

Toll-like receptors (TLRs) are membrane proteins on many cells involved with innate immunity such as macrophages, dendritic cells, neutrophils, mucosal epithelial cells, and endothelial cells.  Ten different mammalian TLRs have been identified and all have distinct specificities for microbial ligands.  Upon recognition of a microbial product, TLRs initiate a signaling pathway to activate innate immunity. TLR9 recognizes bacterial and protozoan associated CpG DNA.

Specificity:Peptide sequence is < 50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR9 and mouse TLR9.

Sequence Alignment:
Human TLR9
SLKYNNLTVVPRNLPSSLEYLLLSYNRIVKL
SLKYNNLTKVPRQLPPSLEYLLVSYNLIVKL
Mouse TLR9

Formulation: Liquid 200 µg of affinity purified antibody at 1 mg/mL in 10 mM KHPO4, 140 mM NaCl with 1 mg/mL BSA and 0.1 % sodium azide.

Quality Control: IH on paraffin sections of human spleen and tonsil

Storage: Freeze at -20° C. For long term storage freeze at -80° C. Avoid freeze-thaw cycles.



capralogics

IH on paraffin section of human spleen Larger image


capralogics
IH on paraffin section of human tonsil Larger image
Contact Capralogics
antibodyinfo@capralogics.com
FAX 1-413-643-0067
Phone 1-800-975-6866

Product Number CIO161
Price $ 295 buy online
Amount 200 µg in 200 µl
Host Goat
Antigen

31 amino acid (aa) synthetic peptide SLKYNNLTVVPRNLPSSLEYLLLSYNRIVKL corresponding to aa 205-235 of the N-terminal domain of Human TLR9
Purification Peptide affinity purified
Species Cross- Reactivity mouse
Buffer 10 mM KHPO4, 140 mM NaCl
pH 7.2
*
Applications and Protocols  
Western Blotting (WB) 1:1000
Immunocytochemistry (IC) acetone fixed cells

1:400
Immunohistochemistry (IH) paraffin sections 1:250
Flow Cytometry ND

capralogics

IH on paraffin section of mouse spleen
Larger image


For Research Purposes Only

References
Chuang TH, Lee J, Kline L, Mathison JC, Ulevitch RJ. Toll-like receptor 9 mediates CpG-DNA signaling. J Leukoc Biol. 2002 Mar;71(3):538-44.  Full Text
Bauer S, Kirschning CJ, Häcker H, Redecke V, Hausmann S, Akira S, Wagner H, Lipford GB.  Human TLR9 confers responsiveness to bacterial DNA via species-specific CpG motif recognition.  Proc Natl Acad Sci U S A. 2001 Jul 31;98(16):9237-42. Full Text
Chuang TH, Ulevitch RJ. Cloning and characterization of a sub-family of human toll-like receptors: hTLR7, hTLR8 and hTLR9.  Eur Cytokine Netw. 2000 Sep;11(3):372-8.  Abstract

Capralogics Home, Chemokine Receptors,, Citations, Contact Us, Custom Polyclonal Antibody Services, FAQ, GLP Compliance, Diagnostic Antibody Production, Interleukins, IVD Antibodies, Licenses and Assurances, "Scrapie Free" Goats, Toll-Like Receptors, Quality Commitment, Welcome to Capralogics