capralogics inc

Human Toll-like receptor 10 (TLR10)

capralogics

Toll-like receptors (TLRs) are membrane proteins on many cells involved with innate immunity such as macrophages, dendritic cells, neutrophils, mucosal epithelial cells, and endothelial cells.  Ten mammalian TLRs have been identified and all have distinct specificities for microbial ligands.  Upon recognition of a microbial product, TLRs initiate a signaling pathway to activate innate immunity. 


Specificity:Peptide sequence is < 50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR10.

Formulation: Liquid 200 µg of affinity purified antibody at 2 mg/mL in 10 mM KHPO4, 140 mM NaCl with 1 mg/mL BSA and 0.1 % sodium azide.

Quality Control: IH on paraffin sections of human spleen and tonsil

Storage: Freeze at -20° C. For long term storage freeze at -80° C. Avoid freeze-thaw cycles.

capralogics

IH on paraffin section of human spleen

Link to larger image

For Research Purposes Only

Contact Capralogics
antibodyinfo@capralogics.com
FAX 1-413-643-0067
Phone 1-800-975-6866

Product Number CIO162

Price $ 295
Amount 200 µg in 100 µl
Host Goat
Antigen

31 amino acid (aa) synthetic peptide C-HNRIQQLDLKTFEFNKELRYLDLSNNRLKSV corresponding to aa 81-111 of the N-terminal domain of Human TLR10

Purification Peptide affinity purified
Species Cross- Reactivity not tested
Buffer 10 mM KHPO4, 140 mM NaCl
pH 7.2
*
Applications and Protocols  
Western Blotting (WB) 1:1000
Immunocytochemistry (IC) acetone fixed cells

1:400

Immunohistochemistry (IH) paraffin sections 1:250
Flow Cytometry ND

capralogics

IH on paraffin section of human tonsil

Link to larger image

References
Bourke E, Bosisio D, Golay J, Polentarutti N, Mantovani A. The toll-like receptor repertoire of human B lymphocytes: inducible and selective expression of TLR9 and TLR10 in normal and transformed cells.  Blood. 2003 Aug 1;102(3):956-63. Full Text
Chuang T, Ulevitch RJ  Identification of hTLR10: a novel human Toll-like receptor preferentially expressed in immune cells.  Biochim Biophys Acta. 2001 Mar 19;1518(1-2):157-61.  Abstract

Capralogics Home, Chemokine Receptors,, Citations, Contact Us, Custom Polyclonal Antibody Services, FAQ, GLP Compliance, Diagnostic Antibody Production, Interleukins, IVD Antibodies, Licenses and Assurances, "Scrapie Free" Goats, Toll-Like Receptors, Quality Commitment, Welcome to Capralogics

©2007 Capralogics, Inc.