capralogics

Antibody to Human IL-21

Capralogics

DATASHEET


Specificity: Peptide sequence is < 50 % identical to other interleukins in this region. The antibody recognizes human IL-21.

Formulation: Liquid 200 µg of affinity purified antibody in 10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide.

Quality Control: Immunocytochemistry on human spleen and/or human tonsil

Storage: Freeze at -20° C. For long term storage freeze at -70° C. Avoid freeze-thaw cycles.

Capralogics

Above: Immunocytochemistry of human spleen with goat antibody to human IL-21 - Larger image

For Research Purposes Only

Contact Capralogics
antibodyinfo@capralogics.com
FAX 1-413-643-0067
Phone 1-800-975-6866

Product Number CIO167

Price $ 295
Amount 200 µg
Host Goat
Antigen Synthetic peptide 78CFQKAQLKSANTGNNERIINVSIKKLKRKPPS109 corresponding to N-terminus region of human IL-21
Sequence Alignment

Human IL-21
CFQKAQLKSANTGNNERIINVSIKKLKRKPPS
CFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPA
Mouse IL-21

Antibody Concentration

1.0 mg/mL

Purification Peptide affinity purified
Species Cross- Reactivity not tested
Buffer 10 mM KHPO4, 140 mM NaCl
pH 7.2

Applications and Protocols

ELISA (for Peptide) 1:100000
Immunocytochemistry See Protocol 1:500
Flow Cytometry ND
Reference
Parrish-Novak J et al. Interleukin 21 and its receptor are involved in NK cell expansion and regulation of lymphocyte function. Nature 2000, 408 (6808), 57-63 Abstract

Capralogics Home, Chemokine Receptors,,Citations, Contact Us, FAQ, GLP Compliance, Diagnostic Antibody Production, Interleukins, IVD Antibodies, Licenses and Assurances, Polyclonal Antibody Production Services, "Scrapie Free" Goats, Toll-Like Receptors, Quality Commitment, Welcome to Capralogics

©2007 Capralogics, Inc.