capralogics

Anti-TRAIL-R3

DATASHEET

Historically, TRAIL-R3 has been referred to as tumor necrosis factor receptor superfamily member 10C precursor, Decoy receptor (DcR1), Decoy TRAIL receptor without death domain, TNF-related apoptosis-inducing ligand receptor 3, TRAIL receptor 3, Trail receptor without an intracellular domain, Lymphocyte inhibitor of TRAIL, Antagonist decoy receptor for TRAIL/Apo-2L, and CD263 antigen. TRAIL induces apoptosis in various types of malignant cells without affecting normal cells.  TRAIL binds to receptors TRAIL-R1, TRAIL-R2, TRAIL-R3, and TRAIL-R4.  Unlike the death receptors, TRAIL-R1 and TRAIL-R2, TRAIL-R3 and TRAIL-R4 bind TRAIL without apoptotic signaling.


Specificity: This antibody recognizes human TRAIL-3 receptor and may cross-react with mouse TRAIL-R3 as Western blotting shows a similar size protein of ~33 kD from mouse spleen. TRAIL-R2 peptide from the same region does not bind to this antibody.  For TRAIL-R1 there is low sequence homology in this region.  This antibody may bind to TRAIL-R4.

Formulation: Liquid 200 µg of affinity purified antibody in 10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide

Quality Control: Western blot or Immunocytochemistry on cell lines HEK 293 or Jurkat.

Storage: Freeze at -20 °C or colder. Stable for at least 3 years when stored at -80°C. Avoid freeze/thaw cycles.

CIO112P - Blocking Peptide to Antibody per 100 µg

 

info@capralogics.com antibodyinfo@capralogics.com
FAX 1-413-643-0067
Phone 1-800-975-6866

Product Number CIO112

Amount 200 µg
Price buy online
Host Goat
Antigen Synthetic peptide EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC aa 33-63, corresponding to the extracellular domain sequence of human TRAIL-R3 (DcR1)
Purification Peptide affinity purified
Species Cross- Reactivity Chimpanzee, Mouse possibly
Buffer 10 mM KHPO4, 140 mM NaCl
pH 7.2
Applications and Protocols  
ELISA (peptide) 1:150,000
Western Blot (WB) 1:300
Immunocytochemistry (IC) 1:250
Immunohistochemistry (IH) 1:50
Flow Cytometry (FC) 1ul/10^6 cells/100ul

For Research Purposes Only

Citations and Applications
Sanlioglu AD, Korcum AF, Pestereli E, Erdogan G, Karaveli S, Savas B, Griffith TS, Sanlioglu S.  TRAIL death receptor-4 expression positively correlates with the tumor grade in breast cancer patients with invasive ductal carcinoma.  Int J Radiat Oncol Biol Phys. 2007 Nov 1;69(3):716-23. Abstract IH
Aydin C, Sanlioglu AD, Karacay B, Ozbilim G, Dertsiz L, Ozbudak O, Akdis CA, Sanlioglu S.  Decoy receptor-2 small interfering RNA (siRNA) strategy employing three different siRNA constructs in combination defeats adenovirus-transferred tumor necrosis factor-related apoptosis-inducing ligand resistance in lung cancer cells.  Hum Gene Ther. 2007 Jan;18(1):39-50  Abstract IH
Secchiero P, Corallini F, di Iasio MG, Gonelli A, Barbarotto E, Zauli G. TRAIL counteracts the proadhesive activity of inflammatory cytokines in endothelial cells by down-modulating CCL8 and CXCL10 chemokine expression and release.  Blood. 2005 May 1;105(9):3413-9.  Full Text FC
Spierings DC, de Vries EG, Vellenga E, van den Heuvel FA, Koornstra JJ, Wesseling J, Hollema H, de Jong S. Tissue distribution of the death ligand TRAIL and its receptors.  J Histochem Cytochem. 2004 Jun;52(6):821-31.  Full Text WB, IH

Basile JR, Zacny V, Munger K. The cytokines tumor necrosis factor-alpha (TNF-alpha ) and TNF-related apoptosis-inducing ligand differentially modulate proliferation and apoptotic pathways in human keratinocytes expressing the human papillomavirus-16 E7 oncoprotein. J Biol Chem. 2001 Jun 22;276(25):22522-8.  Full Text WB