capralogics inc

Human Toll-like receptor 8 (TLR8)

Toll-like receptors (TLRs) are membrane proteins on many cells involved with innate immunity such as macrophages, dendritic cells, neutrophils, mucosal epithelial cells, and endothelial cells.  Ten different mammalian TLRs have been identified and all have distinct specificities for microbial ligands.  Upon recognition of a microbial product, TLRs initiate a signaling pathway to activate innate immunity.  TLR8 recognizes viral associated single-stranded RNA.

Specificity:Peptide sequence is < 50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR8 and mouse TLR8.

Sequence Alignment:
Human TLR8
ESFQGLQNLTKINLNHNPNVQHQNGN
ESFQ+LQNLTKI+LNHN++++QH+N+N
ESFQKLQNLTKIDLNHNAKQQHPNEN
Mouse TLR8

Human TLR8
ESFQGLQNLTKINLNHNPNVQHQNGNPGI
ESFQGLQNLTKINLNHNPNVQ+QNGNPG+
ESFQGLQNLTKINLNHNPNVQRQNGNPGM
Macaca TLR8

Formulation: Liquid 200 µg of affinity purified antibody at 1 mg/mL in 10 mM KHPO4, 140 mM NaCl with 1 mg/mL BSA and 0.1 % sodium azide.

Quality Control: IH on paraffin sections of human tonsil and mouse spleen

Storage: Freeze at -20° C. For long term storage freeze at -80° C. Avoid freeze-thaw cycles.

capralogics

IH on paraffin section of human tonsil
Contact Capralogics

FAX 1-413-643-0067
Phone 1-800-975-6866

Product Number CIO160
Price buy online
Amount 200 µg in 200 µl
Host Goat
Antigen

30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8
Purification Peptide affinity purified
Species Cross- Reactivity mouse
Buffer 10 mM KHPO4, 140 mM NaCl
pH 7.2
*
Applications and Protocols  
Western Blotting (WB) 1:500
Immunocytochemistry (IC) acetone fixed cells

1:200
Immunohistochemistry (IH) paraffin sections 1:125
Flow Cytometry ND

capralogics

IH on paraffin section of mouse spleen

 

For Research Purposes Only
Reference  
Chuang TH, Ulevitch RJ. Cloning and characterization of a sub-family of human toll-like receptors: hTLR7, hTLR8 and hTLR9.  Eur Cytokine Netw. 2000 Sep;11(3):372-8.  Abstract

 

.