Capralogics, Inc., P.O. Box 356, Hardwick, MA 01037 USA
Phone (800) 975-6866 / (413) 477-6866 • FAX (413) 643-0067 •

anti-human IL-21

SKU: CI0167

IC human spleen human IL-21


200 ug
Host Species: 
Synthetic peptide 78CFQKAQLKSANTGNNERIINVSIKKLKRKPPS109 corresponding to N-terminus region of human IL-21
Reactive Species: 
Affinity Purification
Buffer & Formulation: 
Affinity purified antibody @ 1 mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.



Parrish-Novak J et al. Interleukin 21 and its receptor are involved in NK cell expansion and regulation of lymphocyte function. Nature 2000, 408 (6808), 57-63 Abstract

Call (800) 975-6866

Online Payment Service