Capralogics, Inc., P.O. Box 356, Hardwick, MA 01037 USA
Phone (800) 975-6866 / (413) 477-6866 • FAX (413) 643-0067 • capralogics.com

anti-human IL-21 Receptor

$299.00
SKU: CI0149
Synonyms: 
Interleukin 21 Receptor

IH: Human lung IL-21r N-Term

Specifications

Amount: 
200 ug
Host Species: 
Goat
Antigen: 
Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to 35-65 residues of N-terminus of human IL-21 receptor.
Reactive Species: 
Human
Mouse not tested
Format/Conjugates/Purification: 
Affinity Purified
Buffer & Formulation: 
Affinity purified antibody @ 1mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: 
Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: 
Polyclonal

Applications

ELISA: 
1:50,000
IHC: 
1:150
References: 

Ozaki K, Kikly K, Michalovich D, Young PR, Leonard WJ. Cloning of a type 1 cytokine receptor most related to the IL-2 receptor beta chain. Proc Natl Acad Sci U S A. 2000 Oct 10;97(21):11439-44 Full Text

Questions?
Call (800) 975-6866

info@capralogics.com

Share/Save
Online Payment Service