Capralogics, Inc., P.O. Box 356, Hardwick, MA 01037 USA
Phone (800) 975-6866 / (413) 477-6866 • FAX (413) 643-0067 • capralogics.com

anti-human IL-22R-alpha-2

$299.00
SKU: CI0150
Synonyms: 
Interleukin 22 Receptor Alpha 2

CI0150: IH with paraffin section of human spleen

Specifications

Amount: 
200 ug
Host Species: 
Goat
Antigen: 
Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein
Reactive Species: 
Human
Mouse
Rat
Format/Conjugates/Purification: 
Affinity Purified
Buffer & Formulation: 
Affinity purified antibody @ 1mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: 
Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: 
Polyclonal

Applications

ELISA: 
1:50,000
IHC: 
1:150
References: 

Literature Reference: Xu W, Presnell SR, Parrish-Novak J, Kindsvogel W, Jaspers S, Chen Z, Dillon SR, Gao Z, Gilbert T, Madden K, Schlutsmeyer S, Yao L, Whitmore TE, Chandrasekher Y, Grant FJ, Maurer M, Jelinek L, Storey H, Brender T, Hammond A, Topouzis S, Clegg CH, Foster DC. A soluble class II cytokine receptor, IL-22RA2, is a naturally occurring IL-22 antagonist. Proc Natl Acad Sci U S A. 2001 Aug 14;98(17):9511-6. Full Text

Questions?
Call (800) 975-6866

info@capralogics.com

Share/Save
Online Payment Service