Capralogics, Inc., P.O. Box 356, Hardwick, MA 01037 USA
Phone (800) 975-6866 / (413) 477-6866 • FAX (413) 643-0067 • capralogics.com

anti-mouse IL-21 N-terminus

$299.00
SKU: CI0142
Synonyms: 
Interleukin 21

IC Mouse Spleen IL-21 N term

Specifications

Amount: 
200 ug
Host Species: 
Goat
Antigen: 
Synthetic peptide CRHLIDIVEQLKIYENDLDPELLSAPQDVK corresponding to N-terminus of mouse IL-21
Reactive Species: 
Mouse
Human not tested
Format/Conjugates/Purification: 
Affinity Purified
Buffer & Formulation: 
Affinity purified antibody @ 1mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: 
Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: 
Polyclonal

Applications

ELISA: 
1:100,000
IHC: 
1:500
References: 

Liu R, Van Kaer L, La Cava A, Price M, Campagnolo DI, Collins M, Young DA, Vollmer TL, Shi FD.  Autoreactive T cells mediate NK cell degeneration in autoimmune disease. J Immunol.  2006 May 1;176(9):5247-54. Abstract

Questions?
Call (800) 975-6866

info@capralogics.com

Share/Save
Online Payment Service