Capralogics, Inc., P.O. Box 356, Hardwick, MA 01037 USA
Phone (800) 975-6866 / (413) 477-6866 • FAX (413) 643-0067 • capralogics.com

anti-mouse IL-21 Receptor

$299.00
SKU: CI0148
Synonyms: 
Interleukin 21 Receptor

IH mouse thymus IL21R N term

Specifications

Amount: 
200 ug
Host Species: 
Rabbit
Antigen: 
Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouse IL-21 receptor
Reactive Species: 
Mouse
Mouse not tested
Format/Conjugates/Purification: 
Affinity Purified
Buffer & Formulation: 
Affinity purified antibody @ 1mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: 
Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: 
Polyclonal

Applications

ELISA: 
1:100,000
IHC: 
1:300
Flow Cytometry: 
1:20
References: 

He YY, Du MR, Guo PF, He XJ, Zhou WH, Zhu XY, Li DJ.  Regulation of C-C motif chemokine ligand 2 and its receptor in human decidual stromal cells by pregnancy-associated hormones in early gestation. Hum Reprod. 2007 Oct;22(10):2733-42.  Abstract IH
Ebihara N, Yamagami S, Yokoo S, Amano S, Murakami A. Involvement of C-C chemokine ligand 2-CCR2 interaction in monocyte-lineage cell recruitment of normal human corneal stroma.  J Immunol. 2007 Mar 1;178(5):3288-92.  Abstract  IC     
Sakamoto T, Ishibashi T, Sakamoto N, Sugimoto K, Egashira K, Ohkawara H, Nagata K, Yokoyama K, Kamioka M, Ichiki T, Sugimoto N, Kurabayashi M, Suzuki K, Takuwa Y, Maruyama Y.  Endogenous NO blockade enhances tissue factor expression via increased Ca2+ influx through MCP-1 in endothelial cells by monocyte adhesion.  Arterioscler Thromb Vasc Biol. 2005 Sep;25(9): 2005-11. Full Text WB
Vestergaard C, Just H, Baumgartner Nielsen J, Thestrup-Pedersen K, Deleuran M.Expression of CCR2 on monocytes and macrophages in chronically inflamed skin in atopic dermatitis and psoriasis.  Acta Derm Venereol. 2004; 84(5):353- 8.  Abstract IH

Questions?
Call (800) 975-6866

info@capralogics.com

Share/Save
Online Payment Service