Capralogics, Inc., P.O. Box 356, Hardwick, MA 01037 USA
Phone (800) 975-6866 / (413) 477-6866 • FAX (413) 643-0067 • capralogics.com

anti-mouse IL-21 Receptor

$299.00
SKU: CI0156
Synonyms: 
Interleukin 21

IH on mouse thymus with F(ab')2 rabbit antibody to mouse IL-21 receptor

Specifications

Amount: 
100 ul
Host Species: 
Rabbit
Antigen: 
Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouse IL-21 receptor
Reactive Species: 
Mouse
Human not tested
Format/Conjugates/Purification: 
Affinity Purified
Buffer & Formulation: 
Affinity purified antibody in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: 
Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: 
Polyclonal

Applications

ELISA: 
1:50,000
IHC: 
1:250
Flow Cytometry: 
1:25
Comments: 

This F(ab')2 antibody recognizes mouse interleukin-21 receptor and the peptide sequence is less than 50% similiar to other sequences in GenBank in this region.  CI0156 was not tested for cross-reactivity to human IL-21 receptor.

Sequence Alignment of between mouse and human IL-21 receptor:

CVLETRSPNPSILSLTWQDEYEELQDQETF Mouse IL-21 receptor CILEMWNLHPSTLTLTWQDQYEELKDEATS Human IL-21 Receptor

References: 

Comes A, Rosso O, Orengo AM, Di Carlo E, Sorrentino C, Meazza R, Piazza T, Valzasina B, Nanni P, Colombo MP, Ferrini S. CD25+ regulatory T cell depletion augments immunotherapy of micrometastases by an IL-21-secreting cellular vaccine.  J Immunol. 2006 Feb 1;176(3):1750-8. Abstract

Questions?
Call (800) 975-6866

info@capralogics.com

Share/Save
Online Payment Service