Capralogics, Inc., P.O. Box 356, Hardwick, MA 01037 USA
Phone (800) 975-6866 / (413) 477-6866 • FAX (413) 643-0067 • capralogics.com

Adiponutrin 3 (mouse)

$299.00
SKU: CI0175
Synonyms: 
Adiponutrin 3; ADPN3; PNPLA3

CI0175: Antibody to mouse Adiponutrin 3 on paraffin section of mouse skin.

Specifications

Amount: 
200 ug
Host Species: 
Goat
Antigen: 
Synthetic peptide (CVRKARSRNIGTLHPFFNINKCIRDGLQESLPD) corresponding to aa mouse Adiponutrin 3.
Reactive Species: 
Mouse
Format/Conjugates/Purification: 
Peptide Affinity Purification
Buffer & Formulation: 
Liquid. 1 mg/ml affinity purified IgG in PBS with 1 mg/ml BSA and 0.1% sodium azide
Storage: 
Aliquot and freeze at -80C. Stable for 3 years when stored at -80 C.
Clone: 
Polyclonal

Applications

Western Blotting: 
1ug/ml
IHC: 
4ug/ml
Comments: 

Sequence Similarity:

VRKARSRNIGTLHPFFNINKCIRDGLQESLPD  73-104. Mouse Q91WW7
VRKARSRNIGTLHPFFNINKCVRDGLQETLPD  73-104 Rat
VRKARSRNIGIFHPSFNLSKFLRQGLGKCLP 73-103 Human

References: 

Baulande,S.et al, Adiponutrin, a transmembrane protein corresponding to a novel dietary- and obesity-linked mRNA specifically expressed in the adipose lineage J. Biol. Chem. 276 (36), 33336-33344 (2001)

Questions?
Call (800) 975-6866

info@capralogics.com

Share/Save
Online Payment Service