Capralogics, Inc., P.O. Box 356, Hardwick, MA 01037 USA
Phone (800) 975-6866 / (413) 477-6866 • FAX (413) 643-0067 • capralogics.com

anti-human TLR10

$299.00
SKU: CI0162
Synonyms: 
Toll Like Receptor 10, CD290

IH: TLR10 Human Spleen (above). IH: TLR10 Human Tonsil (below).

Specifications

Amount: 
200 ug
Host Species: 
Goat
Antigen: 
31 amino acid (aa) synthetic peptide C-HNRIQQLDLKTFEFNKELRYLDLSNNRLKSV corresponding to aa 81-111 of the N-terminal domain of Human TLR10
Reactive Species: 
Mouse not tested
Format/Conjugates/Purification: 
Affinity Purified
Buffer & Formulation: 
Affinity purified antibody @ 1mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: 
Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: 
Polyclonal

Applications

Western Blotting: 
1:500
IHC: 
1:125
References: 

Bourke E, Bosisio D, Golay J, Polentarutti N, Mantovani A. The toll-like receptor repertoire of human B lymphocytes: inducible and selective expression of TLR9 and TLR10 in normal and transformed cells.  Blood. 2003 Aug 1;102(3):956-63. Full Text
Chuang T, Ulevitch RJ  Identification of hTLR10: a novel human Toll-like receptor preferentially expressed in immune cells.  Biochim Biophys Acta. 2001 Mar 19;1518(1-2):157-61. Abstract

Questions?
Call (800) 975-6866

info@capralogics.com

Share/Save
Online Payment Service