Capralogics, Inc., P.O. Box 356, Hardwick, MA 01037 USA
Phone (800) 975-6866 / (413) 477-6866 • FAX (413) 643-0067 • capralogics.com

anti-human TLR4

$299.00
SKU: CI0159
Synonyms: 
Toll Like Receptor 4, CD284

IH: TLR4 human spleen (above). IH: TLR4 mouse spleen (below left). IH: TLR4 human tonsil (below right).

Specifications

Amount: 
200 ug
Host Species: 
Goat
Antigen: 
Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to aa 161-192 of the N-terminal domain of Human TLR4
Reactive Species: 
Human
Mouse
Format/Conjugates/Purification: 
Affinity Purified
Buffer & Formulation: 
1 mg/ml 10 mM KHPO4, 140 mM NaCl with 1 mg/mL BSA and 0.1 % sodium azide
Storage: 
Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: 
Polyclonal

Applications

Western Blotting: 
1:500
IHC: 
1:125
References: 

Beutler B. TLR4 as the mammalian endotoxin sensor. Curr Top Microbiol Immunol. 2002;270:109-20. Abstract

Questions?
Call (800) 975-6866

info@capralogics.com

Share/Save
Online Payment Service