Capralogics, Inc., P.O. Box 356, Hardwick, MA 01037 USA
Phone (800) 975-6866 / (413) 477-6866 • FAX (413) 643-0067 • capralogics.com

anti-human TLR8

$299.00
SKU: CI0160
Synonyms: 
Toll Like Receptor 8, CD288

IH: TLR8 on mouse spleen (above). IH: TLR8 on Human tonsil (below).

Specifications

Amount: 
200 ug
Host Species: 
Goat
Antigen: 
30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8
Reactive Species: 
Human
Mouse
Format/Conjugates/Purification: 
Affinity Purified
Buffer & Formulation: 
Affinity purified antibody @ 1mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: 
Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: 
Polyclonal

Applications

Western Blotting: 
1:500
IHC: 
1:125
References: 

Chuang TH, Ulevitch RJ. Cloning and characterization of a sub-family of human toll-like receptors: hTLR7, hTLR8 and hTLR9.  Eur Cytokine Netw. 2000 Sep;11(3):372-8. Abstract

Questions?
Call (800) 975-6866

info@capralogics.com

Share/Save
Online Payment Service