Capralogics, Inc., P.O. Box 356, Hardwick, MA 01037 USA
Phone (800) 975-6866 / (413) 477-6866 • FAX (413) 643-0067 • capralogics.com

anti-human TLR5

$299.00
SKU: CI0134
Synonyms: 
Toll/interleukin-1 receptor-like protein 3 (TIL3)

IH of TLR5 on human spleen paraffin

Specifications

Amount: 
200 ug
Host Species: 
Goat
Antigen: 
Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5
Reactive Species: 
Human
Mouse not tested
Format/Conjugates/Purification: 
Affinity Purified
Buffer & Formulation: 
Affinity purified antibody @1mg/ml in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1 % sodium azide
Storage: 
Aliquot and freeze at -20° C. Avoid freeze-thaw cycles.
Clone: 
Polyclonal

Applications

ELISA: 
1:37,500
Western Blotting: 
1:50
IHC: 
1:250
Flow Cytometry: 
1:200
References: 

Crellin NK, Garcia RV, Hadisfar O, Allan SE, Steiner TS, Levings MK. Human CD4+T cells express TLR5 and its ligand flagellin enhances the suppressivecapacity and expression of FOXP3 in CD4+CD25+ T regulatory cells. JImmunol. 2005 Dec 15;175(12):8051-9. Full Text FC

Maase rC, Heidemann J, von Eiff C, Lugering A, Spahn TW, Binion DG, DomschkeW, Lugering N, Kucharzik T. Human intestinal microvascular endothelialcells express Toll-like receptor 5: a binding partner for bacterialflagellin. J Immunol. 2004 Apr 15;172(8):5056-62. Full Text WB

Questions?
Call (800) 975-6866

info@capralogics.com

Share/Save
Online Payment Service